ZFAND5, 1-213aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
ZFAND5 is involved in protein degradation via the ubiquitin-proteasome system. This protein may act by anchoring ubiquitinated proteins to the proteasome and plays a role in ubiquitin-mediated protein degradation during muscle atrophy. ZFAND5 plays a role in the regulation of NF-kappa-B activation and apoptosis and inhibits NF-kappa-B activation triggered by overexpression of RIPK1 and TRAF6 but not of RELA. It inhibits also tumor necrosis factor (TNF), IL-1 and TLR4-induced NF-kappa-B activation in a dose-dependent manner. Recombinant human ZFAND5 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04533
Size 100 µg
Host E.coli
Accession
Molecular Weight 25.5 kDa (236aa) confirmed by MALDI-TOF (Molecular size on SDS-PAGE will appear higher)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMAQETNQTPGPMLCSTGCGFYGNPRTNGMCSVCYKEHLQRQQNSGRMSPMGTASGSNSPTSDSASVQRADTSLNNCEGAAGSTSEKSRNVPVAALPVTQQMTEMSISREDKITTPKTEVSEPVVTQPSPSVSQPSTSQSEEKAPELPKPKKNRCFMCRKKVGLTGFDCRCGNLFCGLHRYSDKHNCPYDYKAEAAAKIRKENPVVVAEKIQRI
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Phosphate buffer saline (pH 8.0) containing 30% glycerol, 1mM DTT
Other Names AN1-type zinc finger protein 5, ZA20D2, ZFAND5A, ZNF216
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap