WWOX, 1-234 aa, Human, His-tagged, Recombinant, E.coli

Categories: [Proteins / Peptides]
WWOX, also known as WW domain containing oxidoreductase, is a proapoptotic protein and a tumor suppressor protein. WWOX is found in all eukaryotes and play an important role in the regulation of a wide variety of cellular functions such as protein degradation, transcription, and RNA splicing. This protein may function synergistically with TP53/p53 to control genotoxic stress-induced cell death. It also plays a role in tumor necrosis factor (TNF)-mediated cell death. Recombinant human WWOX protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04506
Size 50 µg
Host E.coli
Accession
Molecular Weight 28.3 kDa (254aa), confirmed by MALDI-TOF.
AP_Mol_Weight
Tag
Sequences MGSSHHHHHHSSGLVPRGSHMAALRYAGLDDTDSEDELPPGWEERTTKDGWVYYANHTEEKTQWEHPKTGKRKRVAGDLPYGWEQETDENGQVFFVDHINKRTTYLDPRLAFTVDDNPTKPTTRQRYDGSTTAMEILQGRDFTGKVVVVTGANSGIGFETAKSFALHGAHVILACRNMARASEAVSRILEEWQQGAATTVYCAAVPELEGLGGMYFNNCCRCMPSPEAQSEETARTLWALSERLIQERLGSQSG
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH 8.0) containing 10% glycerol
Other Names WW domain containing oxidoreductase, D16S432E, FOR, FRA16D, HHCMA56, PRO0128, SDR41C1, WOX1 , WW domain containing oxidoreductase 5330426P09Rik, 9030416C10Rik, EC 1.1.1.- Fragile site FRA16D Oxireductase
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap