Wnt inhibitory factor 1, 29-379aa, Mouse, His tag, Insect cell

Categories: [Proteins / Peptides]
WIF1, also known as wnt inhibitory factor 1, is a secreted protein that binds to Wnt proteins and inhibits their activities. This protein signaling plays a pivotal role in skeletal development and in the control of cartilage and bone turnover. Also, WIF1 is present in fish, amphibia and mammals, and is expressed during Xenopus and zebrafish development in a complex pattern that includes paraxial presomitic mesoderm, notochord, branchial arches and neural crest derivatives. Recombinant mouse WIF1, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $302
  • Buy 5 for $286.9 each and save 5%
  • Buy 21 for $271.8 each and save 10%
  • Buy 31 for $256.7 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04501
Size 50 µg
Host Insect cell
Accession
Molecular Weight 39.4kDa (359aa) 40-57KDa (SDS-PAGE under reducing conditions.)
AP_Mol_Weight
Tag N-6His
Sequences GQPPEESLYLWIDAHQARVLIGFEEDILIVSEGKMAPFTHDFRKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVNVIVMNSEGNTILRTPQNAIFFKTCQQAECPGGCRNGGFCNERRVCECPDGFYGPHCEKALCIPRCMNGGLCVTPGFCICPPGFYGVNCDKANCSTTCFNGGTCFYPGKCICPPGLEGEQCELSKCPQPCRNGGKCIGKSKCKCPKGYQGDLCSKPVCEPGCGAHGTCHEPNKCQCREGWHGRHCNKRYGASLMHAPRPAGAGLERHTPSLKKAEDRRDPPESNYIWVEHHHHHH
Purity > 95% by HPLC
Concentration 1.0mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In 20mM MES (pH5.5) containing 1mM DTT, 1mM PMSF, 30% glycerol.
Other Names Wif-1, WIF-1, AW107799
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap