WLS, 101-232aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
WLS, a Wnt trafficking regulator, is a multipass transmembrane protein that regulates the sorting and secretion of Wnt protein. It is required for organogenesis during embryogenesis and for the establishment of the anterior-posterior axis. WLS promotes various cancers such as glioma tumourigenesis. The gene encoding WLS maps to human chromosome 1 and is expressed as multiple alternatively spliced isoforms. Recombinant human WLS protein, fused to His-tag at N-terminus, was expressed in E.coli.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04500
Size 50 µg
Host E.coli
Accession
Molecular Weight 17.8 kDa (155aa)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMEMSPWFQFMLFILQLDIAFKLNNQIRENAEVSMDVSLAYRDDAFAEWTEMAHERVPRKLKCTFTSPKTPEHEGRYYECDVLPFMEIGSVAHKFYLLNIRLPVNEKKKINVGIGEIKDIRLVGIHQNGGFTK
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.4M Urea, 10% glycerol
Other Names Protein wntless homolog isoform 1 precursor, C1orf139, EVI, GPR177, MRP
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap