Wif-1, 29-379aa, Human, His-tagged, Recombinant, Hi-5 cell

Categories: [Proteins / Peptides]
Wnt inhibitory factor 1, also known as Wif-1, is a secreted protein that binds to Wnt proteins involved in the embryonic development and cancer, and inhibits their activity. Wif-1 protein contains a WNT inhibitory factor (WIF) domain and 5 epidermal growth factor (EGF)-like domains. It may be involved in mesoderm segmentation. This protein is found to be present in fish, amphibia and mammals. Recombinant human Wif-1 protein, fused to His-tag at C-terminus, was expressed in Hi-5 cell using baculovirus expression system and purified by using conventional chromatography.
List Price: $487
  • Buy 5 for $462.65 each and save 5%
  • Buy 21 for $438.3 each and save 10%
  • Buy 31 for $413.95 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04499
Size 10 µg
Host
Accession
Molecular Weight 39.5 kDa (360 aa) 40-57 KDa (SDS-PAGE under reducing conditions.)
AP_Mol_Weight
Tag
Sequences ADLGPPQEESLYLWIDAHQARVLIGFEEDILIVSEGKMAPFTHDFRKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVDVIVMNSEGNTILQTPQNAIFFKTCQQAECPGGCRNGGFCNERRICECPDGFHGPHCEKALCTPRCMNGGLCVTPGFCICPPGFYGVNCDKANCSTTCFNGGTCFYPGKCICPPGLEGEQCEISKCPQPCRNGGKCIGKSKCKCSKGYQGDLCSKPVCEPGCGAHGTCHEPNKCQCQEGWHGRHCNKRYEASLIHALRPAGAQLRQHTPSLKKAEERRDPPESNYIWHHHHHH
Purity > 95% by HPLC
Concentration 0.20mg/ml (determined by Bradford assay)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 20% glycerol, 0.1mM PMSF, 1mM DTT
Other Names Wnt inhibitory factor 1, WIF1, Wnt inhibitory factor 1
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap