WIBG, 1-204aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
WIBG has been identified as an interacting partner of Mago-Y14. The Mago-Y14 heterodimer is a core component of the EJC(exon junction complex) that is deposited on mRNAs as a consequence of splicing and influences postsplicing mRNA metabolism. This protein is a cytoplasmic RNA-binding protein that is excluded from the nucleus by Crm1. It interacts directly with Mago-Y14 by means of its N-terminal domain. Recombinant human WIBG protein, fused to His-tag at C-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $414
  • Buy 5 for $393.3 each and save 5%
  • Buy 21 for $372.6 each and save 10%
  • Buy 31 for $351.9 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04498
Size 50 µg
Host E.coli
Accession
Molecular Weight 23.7kDa (212aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MEAAGSPAATETGKYIASTQRPDGTWRKQRRVKEGYVPQEEVPVYENKYVKFFKSKPELPPGLSPEATAPVTPSRPEGGEPGLSKTAKRNLKRKEKRRQQQEKGEAEALSRTLDKVSLEETAQLPSAPQGSRAAPTAASDQPDSAATTEKAKKIKNLKKKLRQVEELQQRIQAGEVSQPSKEQLEKLARRRALEEELEDLELGLLEHHHHHH
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 10% glycerol 0.1M NaCl
Other Names PYM, Partner of Y14 and mago
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap