VSTM2L, 25-204aa, Human, His tag E.coli

Categories: [Proteins / Peptides]
VSTM2L, also known as V-set and transmembrane domain containing 2, is a new modulator of HN neuroprotective activity. It colocalizes with HN in distinct brain areas as well as in primary cultured neurons, where it plays a role in the modulation of neuronal viability. When tested in HN neuroprotection bioassays, it acts as a strong antagonist of HN neuroprotective activity. This protein is the first example of a secreted antagonist of HN and may play a role in the modulation of HN biological functions. Recombinant human VSTM2L protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04488
Size 10 µg
Host E.coli
Accession
Molecular Weight 22.6 kDa (205aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSHMTRPAGHAPWDNHVSGHALFTETPHDMTARTGEDVEMACSFRGSGSPSYSLEIQWWYVRSHRDWTDKQAWASNQLKASQQEDAGKEATKISVVKVVGSNISHKLRLSRVKPTDEGSYECRVIDFSDGKARHHKVKAYLRVQPGENSVLHLPEAPPAAPAPPPPKPGKELRKRSVDQEACSL
Purity > 95% by HPLC
Concentration 0.25 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 20% glycerol, 0.1M NaCl,1mM DTT, 0.1mM PMSF
Other Names V-set and transmembrane domain containing 2 like, dJ1118M15.2, C20orf102, V set and transmembrane domain containing 2 like
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap