VOPP1, 82-172aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Vesicular, overexpressed in cancer, prosurvival protein 1(VOPP1), also known as Glioblastoma-amplified secreted protein (GASP), has been previously shown to be over-expressed in human glioblastoma multiforme and squamous cell carcinoma. VOPP1 is a key regulator of NF-kappaB signaling, and that high-level, amplification-mediated VOPP1 expression, such as that occurring in tumors with amplified EGFR, could contribute to resistance to apoptosis. Recombinant human VOPP1 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $414
  • Buy 5 for $393.3 each and save 5%
  • Buy 21 for $372.6 each and save 10%
  • Buy 31 for $351.9 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04479
Size 50 µg
Host E.coli
Accession
Molecular Weight 12 kDa (112aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMRRRMYPPPLIEEPAFNVSYTRQPPNPGPGAQQPGPPYYTDPGGPGMNPVGNSMAMAFQVPPNSPQGSVACPPPPAYCNTPPPPYEQVVKAK
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 1mM DTT, 30% glycerol, 0.2M NaCl
Other Names Vesicular, overexpressed in cancer, prosurvival protein 1, ECOP, GASP
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap