Visinin-like protein-1, 1-191 aa, Human, Recombinant, E.coli

Categories: [Proteins / Peptides]
Visinin-like protein-1, also known as VILIP-1, belongs to a family of neuronal calcium sensor proteins. VILIP-1 is strongly expressed in granule cells of the cerebellum where it associates with membranes in a calcium dependent manner and modulates intracellular signaling pathways of the central nervous system by directly or indirectly regulating the activity of adenylyl cyclase. Also, it is expressed in pancreatic beta-cells. VILIP-1 elevation enhances insulin secretion in cAMP-associated manner. Down-regulation of VILIP-1 decreased cAMP accumulation but increased insulin gene transcription. Recombinant human Visinin-like protein-1 was expressed in E.coli and purified by using conventional chromatography.
List Price: $256
  • Buy 5 for $243.2 each and save 5%
  • Buy 21 for $230.4 each and save 10%
  • Buy 31 for $217.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04478
Size 100 µg
Host E.coli
Accession
Molecular Weight 22.1 kDa (191aa), confirmed by MALDI-TOF.
AP_Mol_Weight
Tag
Sequences MGKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLEEFQQLYVKFFPYGDASKFAQHAFRTFDKNGDGTIDFREFICALSITSRGSFEQKLNWAFNMYDLDGDGKITRVEMLEIIEAIYKMVGTVIMMKMNEDGLTPEQRVDKIFSKMDKNKDDQITLDEFKEAAKSDPSIVLLLQCDIQK
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH8.0) containing 1mM DTT,10% glycerol
Other Names VILIP, VILIP-1, VLP-1, HLP3, VSNL1 , Hippocalcin like protein 3, HLP 3, HPCAL 3, HPCAL3, HUVISL1, Neurocalcin alpha, NVL 1, NVL1, VILIP, Visinin.Visinin like 1, Visinin like protein 1.VISL 1.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap