Data Sheet | Click for Datasheet |
---|---|
Catalog Number | TP04478 |
Size | 100 µg |
Host | E.coli |
Accession | |
Molecular Weight | 22.1 kDa (191aa), confirmed by MALDI-TOF. |
AP_Mol_Weight | |
Tag | |
Sequences | MGKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLEEFQQLYVKFFPYGDASKFAQHAFRTFDKNGDGTIDFREFICALSITSRGSFEQKLNWAFNMYDLDGDGKITRVEMLEIIEAIYKMVGTVIMMKMNEDGLTPEQRVDKIFSKMDKNKDDQITLDEFKEAAKSDPSIVLLLQCDIQK |
Purity | > 95% by HPLC |
Concentration | 1 mg/ml (determined by Bradford assay) |
Formulation | Liquid. In 20mM Tris-HCl buffer (pH8.0) containing 1mM DTT,10% glycerol |
Other Names | VILIP, VILIP-1, VLP-1, HLP3, VSNL1 , Hippocalcin like protein 3, HLP 3, HPCAL 3, HPCAL3, HUVISL1, Neurocalcin alpha, NVL 1, NVL1, VILIP, Visinin.Visinin like 1, Visinin like protein 1.VISL 1. |
Bioactivity | |
Storage | Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles. |
Postscript | For research use only, not for use in diagnostic procedures. |
© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap