VEGF165, 207-371aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Vascular endothelial growth factor (VEGF) is homodimeric, heparin-binding glycoprotein involved in both angiogenesis and vasculogenesis. VEGF is expressed as multiple alternately spliced isoforms of VEGF121, 165, 189 and 206. VEGF binds to the receptor tyrosine kinases VEGF R1 (Flt-1) and VEGF R2 (KDR/Flk-1) to activate signal transduction and regulate both physiological and pathological angiogenesis. Recombinant human VEGF165 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by conventional chromatography, after refolding of the isolated inclusion bodies in a renaturation buffer.
List Price: $500
  • Buy 5 for $475 each and save 5%
  • Buy 21 for $450 each and save 10%
  • Buy 31 for $425 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04472
Size 100 µg
Host E.coli
Accession
Molecular Weight 21.3kDa (185aa), conformed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl(pH8.5), 50%glycerol, 5mM DTT, 200mM NaCl, 2mM EDTA
Other Names Vascular endothelial growth factor A isoform d, VPF, VEGF, VEGF-A
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap