VEGF165, 207-370aa, Human, E.coli

Categories: [Proteins / Peptides]
Vascular endothelial growth factor (VEGF) is homodimeric, heparin-binding glycoprotein involved in both angiogenesis and vasculogenesis. VEGF is expressed as multiple alternately spliced isoforms of VEGF121, 165, 189 and 206. VEGF binds to the receptor tyrosine kinases VEGF R1 (Flt-1) and VEGF R2 (KDR/Flk-1) to activate signal transduction and regulate both physiological and pathological angiogenesis. Recombinant human VEGF165 protein was expressed in E.coli and purified by conventional chromatography, after refolding of the isolated inclusion bodies in a renaturation buffer.
List Price: $550
  • Buy 5 for $522.5 each and save 5%
  • Buy 21 for $495 each and save 10%
  • Buy 31 for $467.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04471
Size 50 µg
Host E.coli
Accession
Molecular Weight 19.3 kDa (166aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 2mM EDTA, 0.1mM PMSF, 1mM DTT, 10% glycerol.
Other Names Vascular endothelial growth factor A, VEGF, MVCD1, VPF
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap