Data Sheet | Click for Datasheet |
---|---|
Catalog Number | TP04468 |
Size | 100 µg |
Host | E.coli |
Accession | |
Molecular Weight | 14.2 kDa (122aa), confirmed by MALDI-TOF. |
AP_Mol_Weight | |
Tag | |
Sequences | MAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRR |
Purity | > 95% by HPLC |
Concentration | 1 mg/ml (determined by Bradford assay) |
Formulation | Liquid in 20 mM Tris-HCl buffer (pH 8.0) containing 10 % glycerol |
Other Names | Vascular endothelial growth factor A isoform f , VPF, VEGF, VEGF-A, Vascular endothelial growth factor A isoform f MVCD1, Vascular endothelial growth factor A, Vascular permeability factor, VEGF A. |
Bioactivity | |
Storage | Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles. |
Postscript | For research use only, not for use in diagnostic procedures. |
© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap