VAPB, 1-222aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
VAPB, also known as vesicle-associated membrane protein (VAMP)-associated protein B, is a type IV transmembrane protein and member of the VAP family of proteins. This protein may play a role in vesicle trafficking. It is found in plasma and intracellular vesicle membranes as a homodimer and heterodimer with VAPA, and interacts with VAMP1 and VAMP2. Defects in VAPB are a cause of amyotrophic lateral sclerosis type 8 and spinal muscular atrophy autosomal dominant Finkel type. Recombinant human VAPB protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04455
Size 100 µg
Host E.coli
Accession
Molecular Weight 27.1 kDa (242aa) confirmed by MALDI-TOF (molecular weight on SDS-PAGE will appear higher)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMAKVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGIIDAGASINVSVMLQPFDYDPNEKSKHKFMVQSMFAPTDTSDMEAVWKEAKPEDLMDSKLRCVFELPAENDKPHDVEINKIISTTASKTETPIVSKSLSSSLDDTEVKKVMEECKRLQGEVQRLREENKQFKEEDGLRMRKTVQSNSPISALAPTGKEEGLST
Purity > 95% by HPLC
Concentration 1.0 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 10% glycerol
Other Names Vesicle-associated membrane protein-associated protein B/C, ALS8, VAMP-B, VAMP-C, VAP-B, VAP-C
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap