Home / Products / proteins / VAPA, 1-227aa, Human, His tag, E.coli

VAPA, 1-227aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
VAPA is a type IV membrane protein, present in the plasma membrane, intracellular vesicles and may also be associated with the cytoskeleton. This protein is a SNARE regulator with high levels of expression in the intestine during late embryogenesis and early neonatal development. VAPA may function in vesicle trafficking, membrane fusion, protein complex assembly and cell motility. Recombinant VAPA protein was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $316
  • Buy 5 for $300.2 each and save 5%
  • Buy 21 for $284.4 each and save 10%
  • Buy 31 for $268.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04454
Size 100 µg
Host E.coli
Accession
Molecular Weight 29.8 kDa (264aa), confirmed by MALDI-TOF.
AP_Mol_Weight
Tag N-6His
Sequences MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSHMASASGAMAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYCVRPNSGIIDPGSTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNTSDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLNDMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSTASFRDNVTSP
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer(pH 8.0) containing 10% glycerol 1mM DTT.
Other Names hVAP-33, VAP-33, VAP-A, VAP33, Vesicle-associated membrane protein-associated protein A VAMP A, VAMP associated protein A, VAP 33, VAP A, Vesicle associated membrane protein associated protein A.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap