VAMP5, 1-72 aa, Human, His-tagged, Recombinant, E.coli

Categories: [Proteins / Peptides]
VAMP5, also known as vesicle-associated membrane protein 5, is a member of the synaptobrevin family and the SNARE superfamily. VAMP5 is the main components of a protein complex involved in the docking and/or fusion of vesicles and cell membranes. This protein may participate in a trafficking events that is associated with myogenesis, such as myoblast fusion and/or GLUT4 trafficking. Recombinant Vamp5 protein was expressed in E.coli and purified by conventional chromatography, after refolding of the isolated inclusion bodies in a renaturation buffer.
List Price: $487
  • Buy 5 for $462.65 each and save 5%
  • Buy 21 for $438.3 each and save 10%
  • Buy 31 for $413.95 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04451
Size 100 µg
Host E.coli
Accession
Molecular Weight 12.7 kDa (109 aa), confirmed by MALDI-TOF.
AP_Mol_Weight
Tag
Sequences MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSHMAGIELERCQQQANEVTEIMRNNFGKVLERGVKLAELQQRSDQLLDMSSTFNKTTQNLAQKKCWENIRYRIC
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH8.0) containing 20% glycerol, 5mM DTT, 0.2M NaCl, 0.5mM EDTA
Other Names Vesicle-associated membrane protein 5, Myobrevin, Vesicle-associated membrane protein 5 Camp, VAMP 5, Vesicle associated membrane protein 5.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap