VAMP4, 1-115 aa, Human, His-tagged, Recombinant, E.coli

Categories: [Proteins / Peptides]
VAMP4, also known as vesicle-associated membrane protein 4, is a member of the synaptobrevin family involved in docking and/or fusion of vesicles with cell membrane. This protein is enriched in the trans-Golgi network and may play a role in trans-Golgi network-to-endosome transport. VAMP4 is involved in the pathway that functions to remove an inhibitor (probably synaptotagmin-4) of calcium-triggered exocytosis during the maturation of secretory granules. Recombinant human VAMP4 protein, fused to His-tag at C-terminus, was expressed in E.coli and purified by using conventional chromatography.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04450
Size 50 µg
Host E.coli
Accession
Molecular Weight 14.5 kDa (123aa), confirmed by MALDI-TOF.
AP_Mol_Weight
Tag
Sequences MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLRGPSGPRFGPRNDKIKHVQNQVDEVIDVMQENITKVIERGERLDELQDKSESLSDNATAFSNRSKQLRRQMWWRGCKLEHHHHHH
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH 8.0) containing 0.1 M NaCl, and 20% glycerol.
Other Names VAMP24, Vesicle-associated membrane protein 4 VAMP 24, VAMP 4, VAMP4 protein, Vesicle associated membrane protein 4, Vesicle associated membrane protein 4, isoform CRA a, Vesicle associated membrane protein 4, isoform CRA b.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap