Data Sheet | Click for Datasheet |
---|---|
Catalog Number | TP04449 |
Size | 10 µg |
Host | E.coli |
Accession | |
Molecular Weight | 12.8 kDa (118aa) Confirmed by MALDI-TOF |
AP_Mol_Weight | |
Tag | |
Sequences | MGSSHHHHHHSSGLVPRGSHMGSHMSATAATVPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLK |
Purity | > 95% by HPLC |
Concentration | 0.5 mg/ml (determined by Bradford assay) |
Formulation | : Liquid. In Phosphate Buffered Saline (pH7.4) containing 1mM EDTA, 0.1mM PMSF, 10% glycerol |
Other Names | Vesicle-associated membrane protein 2, Syb-2, Syb2, sybII |
Bioactivity | |
Storage | Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles. |
Postscript | For research use only, not for use in diagnostic procedures. |
© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap