Vamp2, 1-94aa, Mouse, His-tag, E.coli

Categories: [Proteins / Peptides]
Vamp2, also known as Vesicle-associated membrane protein 2, is involved in the targeting and/or fusion of transport vesicles to their target membrane. It modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1. Vamp2 proteins localized to the cytoplasmic surface of synaptic vesicle, consists of a proline-rich N-terminal region, a highly conserved hydrophilic domain, followed by a transmembrane anchor and a C-terminal. This proteins also known to mediate cAMP-stimulated exocytosis in nerve cells and in renal cells of the juxtaglomerular apparatus. Recombinant mouse Vamp2 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography
List Price: $355
  • Buy 5 for $337.25 each and save 5%
  • Buy 21 for $319.5 each and save 10%
  • Buy 31 for $301.75 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04449
Size 10 µg
Host E.coli
Accession
Molecular Weight 12.8 kDa (118aa) Confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MGSSHHHHHHSSGLVPRGSHMGSHMSATAATVPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLK
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation : Liquid. In Phosphate Buffered Saline (pH7.4) containing 1mM EDTA, 0.1mM PMSF, 10% glycerol
Other Names Vesicle-associated membrane protein 2, Syb-2, Syb2, sybII
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap