Data Sheet | Click for Datasheet |
---|---|
Catalog Number | TP04393 |
Size | 50 µg |
Host | E.coli |
Accession | |
Molecular Weight | 45.2kDa (398aa) confirmed by MALDI-TOF |
AP_Mol_Weight | |
Tag | N-6His |
Sequences | MGSSHHHHHHSSGLVPRGSHMGSMSVSGLKAELKFLASIFDKNHERFRIVSWKLDELHCQFLVPQQGSPHSLPPPLTLHCNITESYPSSSPIWFVDSEDPNLTSVLERLEDTKNNNLLRQQLKWLICELCSLYNLPKHLDVEMLDQPLPTGQNGTTEEVTSEEEEEEEEMAEDIEDLDHYEMKEEEPISGKKSEDEGIEKENLAILEKIRKTQRQDHLNGAVSGSVQASDRLMKELRDIYRSQSYKTGIYSVELINDSLYDWHVKLQKVDPDSPLHSDLQILKEKEGIEYILLNFSFKDNFPFDPPFVRVVLPVLSGGYVLGGGALCMELLTKQGWSSAYSIESVIMQINATLVKGKARVQFGANKNQYNLARAQQSYNSIVQIHEKNGWYTPPKEDG |
Purity | > 95% by HPLC |
Concentration | 0.5mg/ml (determined by Absorbance at 280nm) |
Formulation | Liquid. In Phosphate Buffer Saline (pH7.4) containing 30% glycerol, 1mM DTT |
Other Names | Ubiquitin-conjugating enzyme E2 Q2 isoform1 , UB2Q2, Ubiquitin carrier protein Q2, Ubiquitin conjugating enzyme E2Q |
Bioactivity | |
Storage | Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles. |
Postscript | For research use only, not for use in diagnostic procedures. |
© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap