Data Sheet | Click for Datasheet |
---|---|
Catalog Number | TP04279 |
Size | 100 µg |
Host | E.coli |
Accession | |
Molecular Weight | 16.8 kDa (151 aa), confirmed by MALDI-TOF. |
AP_Mol_Weight | |
Tag | |
Sequences | MGSSHHHHHHSSGLVPRGSHMEAQAQGLLETEPLQGTDEDAVASADFSSMLSEEEKEELKAELVQLEDEITTLRQVLSAKERHLVEIKQKLGMNLMNELKQNFSKSWHDMQTTTAYKKTHETLSHAGQKATAAFSNVGTAISKKFGDMRRK |
Purity | > 95% by HPLC |
Concentration | 1 mg/ml (determined by Bradford assay) |
Formulation | Liquid. In PBS (pH 7.4) |
Other Names | Tpd52l1, TPD52L1 , mD53, Tumor protein D52-like 1, Tumor protein D53, Tumor protein D52-like 1 isoform 4 D53, D54, hD53, hD54, MGC73020, MGC8556, TPD52L2, Tumor protein D52 like 1, Tumor protein D52 like 2, Tumor protein D53, Tumor protein D54, |
Bioactivity | |
Storage | Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles. |
Postscript | For research use only, not for use in diagnostic procedures. |
© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap