Data Sheet | Click for Datasheet |
---|---|
Catalog Number | TP04245 |
Size | 50 µg |
Host | Baculovirus |
Accession | |
Molecular Weight | 45.8kDa (407aa), 25-50kDa (SDS-PAGE under reducing conditions) |
AP_Mol_Weight | |
Tag | N-6His |
Sequences | ADLMSGLGRSRRGGRSRVDQEERFPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELRRQRSGEVENNSDNSGRYQGLEHRGSEASPALPGLKLSADQVALVYSLEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH |
Purity | > 95% by HPLC |
Concentration | 0.25mg/ml (determined by Absorbance at 280nm) |
Formulation | Liquid. In Phosphate Buffered Saline (pH 7.4) containing 30% glycerol, 1mM DTT. |
Other Names | Tumor necrosis factor receptor superfamily member 13B, TNFRSF13B, CD267, CVID, CVID2, IGAD2, RYZN, TACI, TNFRSF14B, CD 267, CD267 antigen,. |
Bioactivity | |
Storage | Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles. |
Postscript | For research use only, not for use in diagnostic procedures. |
© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap