Home / Products / proteins / TNFRSF10C, 26-236aa, Human, His tag, E.coli

TNFRSF10C, 26-236aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
TNFRSF10C also known as tumor necrosis factor receptor superfamily member 10C is a member of the TNF-receptor superfamily. This receptor contains an extracellular TRAIL-binding domain and a transmembrane domain, but no cytoplasmic death domain. This receptor is not capable of inducing apoptosis, and is thought to function as an antagonistic receptor that protects cells from TRAIL-induced apoptosis. Recombinant human TNFRSF10C, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04242
Size 100 µg
Host E.coli
Accession
Molecular Weight 24.6kDa (234aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPA
Purity > 95% by HPLC
Concentration 1mg/ml (determined by BCA assay)
Formulation Liquid, In Phosphate buffered saline (pH7.4) containing 10% glycerol
Other Names Tumor necrosis factor receptor superfamily member 10C, CD263, DCR1, DCR1-TNFR, LIT, TRAIL-R3, TRAILR3, TRID
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap