TIMP4, 30-224aa, Human, His-tag, Baculovirus

Categories: [Proteins / Peptides]
TIMP4, as known as metalloproteinase inhibitor 4, is a family of secreted protein that regulates the activation and proteolytic activity of the zinc enzymes known as matrix metalloproteinases. There are four known members of the family, TIMP1, 2, 3 and 4. TIMP4 is produced by a wide range of tissues, particularly brain, heart, ovary and skeletal muscle. Limited studies have shown that this protein has a tumor suppressive effect against Wilm s tumor, exhibits negative correlation with glioma malignancy and is found in breast carcinoma cells. Recombinant human TIMP4, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $355
  • Buy 5 for $337.25 each and save 5%
  • Buy 21 for $319.5 each and save 10%
  • Buy 31 for $301.75 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04223
Size 10 µg
Host Baculovirus
Accession
Molecular Weight 23.5kDa (204aa), 18-28kDa (SDS-PAGE under reducing conditions)
AP_Mol_Weight
Tag
Sequences ADPCSCAPAHPQQHICHSALVIRAKISSEKVVPASADPADTEKMLRYEIKQIKMFKGFEKVKDVQYIYTPFDSSLCGVKLEANSQKQYLLTGQVLSDGKVFIHLCNYIEPWEDLSLVQRESLNHHYHLNCGCQITTCYTVPCTISAPNECLWTDWLLERKLYGYQAQHYVCMKHVDGTCSWYRGHLPLRKEFVDIVQPHHHHHH
Purity > 95% by HPLC
Concentration 0.25mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol
Other Names Metalloproteinase inhibitor 4 , TIMP4, TIMP-4, Metalloproteinase inhibitor 4TIMP 4, TIMP metallopeptidase inhibitor 4TIMP-4, Timp4, TIMP4_HUMANTissue inhibitor of metalloproteinase 4Tissue inhibitor of metalloproteinases 4.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap