TIMP2, 27-220aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
TIMP2 is a natural inhibitor of the matrix metalloproteinases, a group of peptidases involved in of the extracellular matrix. In addition to an inhibitory role against metalloproteinases, this protein has a unique role among TIMP family members in its ability to directly suppress the proliferation of endothelial cells. As a result, TIMP2 may be critical to the maintenance of tissue homeostasis by suppressing the proliferation of quiescent tissues in response to angiogenic factors, and by inhibiting protease activity in tissues undergoing remodelling of the extracellular. Recombinant human TIMP2 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04221
Size 100 µg
Host E.coli
Accession
Molecular Weight 26.1 kDa (232aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSHMCSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.15M NaCl, 10% glycerol, 1mM DTT
Other Names TIMP metallopeptidase inhibitor 2, CSC-21K, CSC21K
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap