Home / Products / proteins / THYN1, 1-225aa, Human, His tag, E.coli

THYN1, 1-225aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Thymocyte nuclear protein 1, also known THYN1, is highly conserved among vertebrates and plant species and may be involved in the induction of apoptosis. Also, THYN1 in the thymocytes was mainly localized in the nucleus, as recently demonstrated in lymphoma cells, indicating that the THYN1 resides in the nucleus, irrespective of the cyclic or resting stage of the cell cycle. Recombinant human THYN1 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04212
Size 100 µg
Host E.coli
Accession
Molecular Weight 27.8 kDa (245aa) confirmed by MALDI-TOF (molecular weight on SDS-PAGE will appear higher)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMSRPRKRLAGTSGSDKGLSGKRTKTENSGEALAKVEDSNPQKTSATKNCLKNLSSHWLMKSEPESRLEKGVDVKFSIEDLKAQPKQTTCWDGVRNYQARNFLRAMKLGEEAFFYHSNCKEPGIAGLMKIVKEAYPDHTQFEKNNPHYDPSSKEDNPKWSMVDVQFVRMMKRFIPLAELKSYHQAHKATGGPLKNMVLFTRQRLSIQPLTQEEFDFVLSLEEKEPS
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 1mM DTT, 20% glycerol, 100mM NaCl
Other Names Thymocyte nuclear protein 1, HSPC144, MDS012, MY105, THY28, THY28KD
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap