THY1, 20-130aa, Human, His tag, Baculovirus

Categories: [Proteins / Peptides]
THY1, as known as Thy-1 membrane glycoprotein, is a cell membrane protein which contains 1lg-like V-type (immunoglobulin-like) domain. This protein is a member of the immunoglobulin superfamily of adhesion molecules with constitutive expression on fibroblast cells. It can be used as a marker for a variety of stem cells and for the axonal processes of mature neurons. Also, this protein led to some of the initial biochemical description and characterization of a vertebrate glycophosphatidylinositol (GPI) anchor and also the first demonstration of tissue specific differential glycosylation. Recombinant human THY1, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $302
  • Buy 5 for $286.9 each and save 5%
  • Buy 21 for $271.8 each and save 10%
  • Buy 31 for $256.7 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04211
Size 20 µg
Host Baculovirus
Accession
Molecular Weight 13.3kDa (117aa), 13.5-28kDa (SDS-PAGE under reducing conditions)
AP_Mol_Weight
Tag N-6His
Sequences QKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKCHHHHHH
Purity > 95% by HPLC
Concentration 0.25mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names Thy-1 membrane glycoprotein, THY1, CD90, CDw90, CD7, CD90 antigen, CDw90, FLJ33325, MGC128895, T25, Theta antigen, Thy 1, Thy 1 cell surface antigen, Thy 1 membrane glycoprotein.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap