Data Sheet | Click for Datasheet |
---|---|
Catalog Number | TP04211 |
Size | 20 µg |
Host | Baculovirus |
Accession | |
Molecular Weight | 13.3kDa (117aa), 13.5-28kDa (SDS-PAGE under reducing conditions) |
AP_Mol_Weight | |
Tag | N-6His |
Sequences | QKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKCHHHHHH |
Purity | > 95% by HPLC |
Concentration | 0.25mg/ml (determined by Absorbance at 280nm) |
Formulation | Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol. |
Other Names | Thy-1 membrane glycoprotein, THY1, CD90, CDw90, CD7, CD90 antigen, CDw90, FLJ33325, MGC128895, T25, Theta antigen, Thy 1, Thy 1 cell surface antigen, Thy 1 membrane glycoprotein. |
Bioactivity | |
Storage | Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles. |
Postscript | For research use only, not for use in diagnostic procedures. |
© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap