Home / Products / proteins / Thioredoxin2, 60-166 aa, Human, Recombinant, E.coli

Thioredoxin2, 60-166 aa, Human, Recombinant, E.coli

Categories: [Proteins / Peptides]
Thioredoxin(Trx) is a low molecular weight redox protein. Trx contains a redox active disulfide/dithiol group within the conserved Cys-Gly-Pro-Cys active site. The Thioredoxin2 may play important roles in the regulation of the mitochondrial membrane potential and in protection against oxidant-induced apoptosis. Recombinant Thioredoxin2 was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $473
  • Buy 5 for $449.35 each and save 5%
  • Buy 21 for $425.7 each and save 10%
  • Buy 31 for $402.05 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04205
Size 100 µg
Host E.coli
Accession
Molecular Weight 11 kDa (108 aa), confirmed by MALDI-TOF.
AP_Mol_Weight
Tag
Sequences MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid in Phosphate-Buffered Saline (pH 7.4)
Other Names MTRX, TRX2, MT-TRX, Thioredoxin2 , mitochondrial thioredoxin, thioredoxin 2 precursor, Thioredoxin mitochondrial, TRX 2, TXN 2, TXN2, Thioredoxin-2
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap