Home / Products / proteins / Thioredoxin-1 Human, Recombinant, E.coli

Thioredoxin-1 Human, Recombinant, E.coli

Categories: [Proteins / Peptides]
Thioredoxin(Trx) is a low molecular weight redox protein. Trx contains a redox active disulfide/dithiol group within the conserved Cys-Gly-Pro-Cys active site. It is involved in the first unique step in DNA synthesis. Trx also provides control over a number of transcription factors affecting cell proliferation and death through a mechanism referred to as redox regulation. Recombinant human thioredoxin-1 was overexpressed in E. coli and purified by using conventional chromatography techniques
List Price: $248
  • Buy 5 for $235.6 each and save 5%
  • Buy 21 for $223.2 each and save 10%
  • Buy 31 for $210.8 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04204
Size 100 µg
Host E.coli
Accession
Molecular Weight 11.7 kDa (105 aa), confirmed by MALDI-TOF.
AP_Mol_Weight
Tag
Sequences MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by BCA assay).
Formulation Liquid. In Phosphate buffer saline(PBS), pH 7.4
Other Names TRX1, TRX2, Thioredoxin-1, Thioredoxin I, TR-I, Thioredoxin-2, Thioredoxin-1, ADF, Surface associated sulphydryl protein, TXN protein, ATL derived factor, DKFZp686B1993, MGC61975, SASP, Thioredoxin, TRDX, TRX, TRX 1, TXN,
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap