Thioredoxin 1, 2-109aa, E.coli, His tag, E.coli

Categories: [Proteins / Peptides]
Thioredoxin 1(Trx) is a low molecular weight redox protein. Trx contains a redox active disulfide/dithiol group within the conserved Cys-Gly-Pro-Cys active site. It is involved in the first unique step in DNA synthesis. Trx also provides control over a number of transcription factors affecting cell proliferation and death through a mechanism referred to as redox regulation. Recombinant E.coli TXN protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04203
Size 50 µg
Host E.coli
Accession
Molecular Weight 12.9 kDa (119aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MHHHHHHMGSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In 20mM Tris-HCl buffer(pH 8.0) containing 10% glycerol, 1mM DTT.
Other Names dasC, fipA, tsnC,
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap