THG1L, 30-298aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Probable tRNA (His) guanylyltransferase, also known as THG1L, belongs to the tRNA (His) gyanylytransferase family. Localized to the cytoplasm, THG1L is also found near the nuclear membrane and is expressed in many tissues, including liver and lung. Upon DNA damage, THG1L is phosphorylated, most likely by ATM or ATR. It is expressed in a cell cycle-dependent manner and may be involved in cell cycle progression and cell proliferation. Recombinant human THG1L protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04202
Size 20 µg
Host E.coli
Accession
Molecular Weight 34 kDa (292aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMAKSKFEYVRDFEADDTCLAHCWVVVRLDGRNFHRFAEKHNFAKPNDSRALQLMTKCAQTVMEELEDIVIAYGQSDEYSFVFKRKTNWFKRRASKFMTHVASQFASSYVFYWRDYFEDQPLLYPPGFDGRVVVYPSNQTLKDYLSWRQADCHINNLYNTVFWALIQQSGLTPVQAQGRLQGTLAADKNEILFSEFNINYNNELPMYRKGTVLIWQKVDEVMTKEIKLPTEMEGKKMAVTRTRTKPVPLHCDIIGDAFWKEHPEILDEDS
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.1M NaCl, 20% glycerol,1mM DTT
Other Names Probable tRNA (His) guanylyltransferase, ICF45
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap