Home / Products / proteins / THAP1, 1-213 aa, Human, His tag, E.coli

THAP1, 1-213 aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
THAP domain-containing protein 1, also known as THAP1, is a 213 amino acid protein that localizes to the nucleoplasm and contains one THAPtype zinc finger, a conserved DNA-binding domain. It is a DNA-binding transcription regulator that regulates endothelial cell proliferation and G1/S cell-cycle progression. THAP1 may also have pro-apoptopic activity by potentiating both serum-withdrawal and TNF-induced apoptosis. Recombinant human THAP1protein, fused to His-tag at N-terminus, was expressed in E.coli.
List Price: $487
  • Buy 5 for $462.65 each and save 5%
  • Buy 21 for $438.3 each and save 10%
  • Buy 31 for $413.95 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04198
Size 100 µg
Host E.coli
Accession
Molecular Weight 27.5 kDa (237aa)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSHMVQSCSAYGCKNRYDKDKPVSFHKFPLTRPSLCKEWEAAVRRKNFKPTKYSSICSEHFTPDCFKRECNNKLLKENAVPTIFLCTEPHDKKEDLLEPQEQLPPPPLPPPVSQVDAAIGLLMPPLQTPVNLSVFCDHNYTVEDTMHQRKRIHQLEQQVEKLRKKLKTAQQRCRRQERQLEKLKEVVHFQKEKDDVSERGYVILPNDYFEIVEVPA
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 2M Urea, 10% glycerol, 1mM DTT, 0.2M NaCl
Other Names THAP domain-containing protein 1, DYT6
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap