TGFBR2, 23-166aa, Human, hIgG-His tag, Baculovirus

Categories: [Proteins / Peptides]
TGFBR2, as known as TGF-beta receptor type-2 isoform B, is a member of the serine and threonine protein kinase family and the TGF beta receptor subfamily. The type-2 receptor binds TGF-beta1 and TGF-beta3 with high affinity, and TGF-beta2 with a much lower affinity. It forms a heterodimeric complex with type1 receptor and is essential for signal transduction. Also, this protein may play an important role in TGF-beta2 binding and signaling in cells lacking TGFBR3. Recombinant human TGFBR2, fused to hIgG-His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $302
  • Buy 5 for $286.9 each and save 5%
  • Buy 21 for $271.8 each and save 10%
  • Buy 31 for $256.7 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04191
Size 50 µg
Host Baculovirus
Accession
Molecular Weight 43.3kDa (383aa); 40-57kDa (SDS-PAGE under reducing conditions)
AP_Mol_Weight
Tag N-6His
Sequences TIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPDLLLVIFQLEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names TGF-beta receptor type-2 isoform B, TGFBR2, AAT3, FAA3, LDS1B, LDS2, LDS2B, MFS2, RIIC, TAAD2, TGF beta-RII, TGFR-2
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap