TGF β1, 279-390 aa, Human, Recombinant, E.coli

Categories: [Proteins / Peptides]
Transforming growth factor beta 1(TGF-beta1) is a polypeptide member of the transforming growth factor beta superfamily of cytokines. It is a secreted protein that performs many cellular functions, including the control of cell growth, cell proliferation, cell differentiation and apoptosis. Many cells synthesize TGFb1 and almost all of them have specific receptors for it. It positively and negatively regulates many other growth factors. Also, TGF-beta1 plays an important role in bone remodeling, controlling the immune system, and shows different activities on different types of cell, or cells at different developmental stages. Recombinant TGF-beta1 protein was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $600
  • Buy 5 for $570 each and save 5%
  • Buy 21 for $540 each and save 10%
  • Buy 31 for $510 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04188
Size 100 µg
Host E.coli
Accession
Molecular Weight 12.9 kDa (113aa), confirmed by MALDI-TOF.
AP_Mol_Weight
Tag
Sequences MALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In 10mM Sodium Citrate (pH3.5) containing, 10% glycerol
Other Names CED, DPD1, TGFB, Transforming growth factor beta 1, TGFB1, TGFbeta, Camurati-Engelmann disease,
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap