Home / Products / proteins / TFPI2, 23-213aa, Human, His tag, Baculovirus

TFPI2, 23-213aa, Human, His tag, Baculovirus

Categories: [Proteins / Peptides]
TFPI2, as known as tissue factor pathway inhibitor 2 isoform 1, is a kunitz-type serine proteinase inhibitor, which is produced and secreted into endothelial cell matrix (ECM) by endothelial cells, smooth muscle cells, fibroblasts, keratinocytes, and urothelium. Also, this protein has been shown to inhibit ECM proteases essential for angiogenesis and metastasis. Recombinant human TFPI2, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $302
  • Buy 5 for $286.9 each and save 5%
  • Buy 21 for $271.8 each and save 10%
  • Buy 31 for $256.7 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04186
Size 20 µg
Host Baculovirus
Accession
Molecular Weight 22.9kDa (199aa); 18-40kDa (SDS-PAGE under reducing conditions)
AP_Mol_Weight
Tag N-6His
Sequences DAAQEPTGNNAEICLLPLDYGPCRALLLRYYYDRYTQSCRQFLYGGCEGNANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSMTCEKFFSGGCHRNRIENRFPDEATCMGFCAPKKIPSFCYSPKDEGLCSANVTRYYFNPRYRTCDAFTYTGCGGNDNNFVSREDCKRACAKALKLEHHHHHH
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names Tissue factor pathway inhibitor 2 isoform 1, TFPI2, PP5, REF1, TFPI-2
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap