Data Sheet | Click for Datasheet |
---|---|
Catalog Number | TP04186 |
Size | 20 µg |
Host | Baculovirus |
Accession | |
Molecular Weight | 22.9kDa (199aa); 18-40kDa (SDS-PAGE under reducing conditions) |
AP_Mol_Weight | |
Tag | N-6His |
Sequences | DAAQEPTGNNAEICLLPLDYGPCRALLLRYYYDRYTQSCRQFLYGGCEGNANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSMTCEKFFSGGCHRNRIENRFPDEATCMGFCAPKKIPSFCYSPKDEGLCSANVTRYYFNPRYRTCDAFTYTGCGGNDNNFVSREDCKRACAKALKLEHHHHHH |
Purity | > 95% by HPLC |
Concentration | 0.5mg/ml (determined by Absorbance at 280nm) |
Formulation | Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol. |
Other Names | Tissue factor pathway inhibitor 2 isoform 1, TFPI2, PP5, REF1, TFPI-2 |
Bioactivity | |
Storage | Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles. |
Postscript | For research use only, not for use in diagnostic procedures. |
© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap