TFF1, 25-84aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
TFF1 (Trefoil factor 1) is member of trefoil family, characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. Trefoil peptides are protease resistant molecules secreted throughout the gut that play a role in mucosal healing. TFF1 has also been detected in a number of carcinomas including cancers of the breast, pancreas and stomach. Recombinant human TFF1 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $414
  • Buy 5 for $393.3 each and save 5%
  • Buy 21 for $372.6 each and save 10%
  • Buy 31 for $351.9 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04184
Size 50 µg
Host E.coli
Accession
Molecular Weight 9.0kDa (81aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMEAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 1mM DTT, 20% glycerol, 100mM NaCl, 0.1mM PMSF
Other Names Trefoil factor 1, pS2, BCEI, HPS2, HP1.A, pNR-2
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap