TCL1A, 1-114 aa, Human, Recombinant, E.coli

Categories: [Proteins / Peptides]
TCL1A, also known as T-cell leukemia/lymphoma 1A, is a protein with a suggested role in intracellular regulation of T cell signaling. TCL1A binds to the pleckstrin homology domain of Akt (protein kinase B) family proteins, which facilitates Akt dimerization and activity. By increasing Akt activity TCL1A may enhance the serine/threonine phosphorylation of major Akt signaling substrates, such as Ikk complex, mTOR, BAD, p70S6 kinase, FOXO transcription factors, and GSK3b. These substrates regulate cellular differentiation, growth, survival, and metabolism. Recombinant TCL1A protein was expressed in E.coli and purified by using conventional chromatography techniques
List Price: $256
  • Buy 5 for $243.2 each and save 5%
  • Buy 21 for $230.4 each and save 10%
  • Buy 31 for $217.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04170
Size 100 µg
Host E.coli
Accession
Molecular Weight 13.4 kDa (114aa), confirmed by MALDI-TOF. (Molecular weight on SDS-PAGE will appear higher)
AP_Mol_Weight
Tag
Sequences MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 50mM Tris-HCl buffer (pH7.5) containing 10% glycerol
Other Names TCL1, TCL-1, protein p14TCL1, Oncogene TCL1, T-cell leukemia/lymphoma 1A anti TCL1A, P14 TCL1, P14 TCL1 protein, T cell leukemia 1, T cell lymphoma 1, T cell lymphoma 1A, TCL 1 protein, TCL1 oncogene, TCL1 PEN, TCL1A, TCL1A.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap