Data Sheet | Click for Datasheet |
---|---|
Catalog Number | TP04170 |
Size | 100 µg |
Host | E.coli |
Accession | |
Molecular Weight | 13.4 kDa (114aa), confirmed by MALDI-TOF. (Molecular weight on SDS-PAGE will appear higher) |
AP_Mol_Weight | |
Tag | |
Sequences | MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD |
Purity | > 95% by HPLC |
Concentration | 1 mg/ml (determined by Bradford assay) |
Formulation | Liquid. In 50mM Tris-HCl buffer (pH7.5) containing 10% glycerol |
Other Names | TCL1, TCL-1, protein p14TCL1, Oncogene TCL1, T-cell leukemia/lymphoma 1A anti TCL1A, P14 TCL1, P14 TCL1 protein, T cell leukemia 1, T cell lymphoma 1, T cell lymphoma 1A, TCL 1 protein, TCL1 oncogene, TCL1 PEN, TCL1A, TCL1A. |
Bioactivity | |
Storage | Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles. |
Postscript | For research use only, not for use in diagnostic procedures. |
© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap