TCEB1, 1-112 aa, Human, His tag E.coli

Categories: [Proteins / Peptides]
TCEB1 (elongin C) is a subunit of elongin, which is a general transcription elongation factor that increases the RNA polymerase II transcription elongation past template encoded arresting sites. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau(VHL) tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation. Recombinant human TCEB1 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04167
Size 100 µg
Host E.coli
Accession
Molecular Weight 14.6 kDa (132aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford)
Formulation Liquid. In 20mM Tris-HCl buffer(pH 8.0) containing 10% glycerol, 1mM DTT, 0.15M NaCl.
Other Names Transcription elongation factor B polypeptide 1, SIII, Elongin-C
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap