Home / Products / proteins / TCEAL8, 1-117aa , Human, His tag, E.coli

TCEAL8, 1-117aa , Human, His tag, E.coli

Categories: [Proteins / Peptides]
TCEAL8 (Transcription elongation factor A protein-like 8), also known as TCEA-like protein 8, belongs to the TFS-II family and TFA subfamily. This protein is involved in transcriptional regulation and localized in nucleus. Recombinant human TCEAL8 protein, fused to His-tag at C-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04166
Size 50 µg
Host E.coli
Accession
Molecular Weight 14.7kDa (125aa), confirmed by MALDI-TOF (Molecular weight on SDS-PAGE will appear higher)
AP_Mol_Weight
Tag N-6His
Sequences MQKSCEENEGKPQNMPKAEEDRPLEDVPQEAEGNPQPSEEGVSQEAEGNPRGGPNQPGQGFKEDTPVRHLDPEEMIRGVDELERLREEIRRVRNKFVMMHWKQRHSRSRPYPVCFRPLEHHHHHH
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer, pH8.0, 20% glycerol, 1mM DTT, 200mM NaCl
Other Names transcription elongation factor A (SII)-like 8,
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap