TCEAL1, 1-159aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
TCEAL1 (Transcription elongation factor A protein-like 1) is belongs to transcription elongation factor A (SII)-like (TCEAL) family. This family may function as nuclear phosphoproteins that modulate transcription in a promoter context-dependent manner. It involved in transcriptional regulation. This protein expressed in all tissues, especially highly expressed in heart, ovary, prostate and skeletal muscle. Recombinant human TCEAL1 protein, fused to His-tag at C-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04163
Size 100 µg
Host E.coli
Accession
Molecular Weight 19.7kDa (167aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MDKPRKENEEEPQSAPKTDEERPPVEHSPEKQSPEEQSSEEQSSEEEFFPEELLPELLPEMLLSEERPPQEGLSRKDLFEGRPPMEQPPCGVGKHKLEEGSFKERLARSRPQFRGDIHGRNLSNEEMIQAADELEEMKRVRNKLMIMHWKAKRSRPYPILEHHHHHH
Purity > 95% by HPLC
Concentration 1mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 2mM DTT, 20% glycerol, 0.1M NaCl
Other Names Transcription elongation factor A protein-like 1, p21, pp21, SIIR
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap