Home / Products / proteins / TBCA, 1-108aa, Human, Recombinant, E.coli

TBCA, 1-108aa, Human, Recombinant, E.coli

Categories: [Proteins / Peptides]
Tubulin folding cofactor A, also known as TBCA, is one of four proteins (cofactors A, D, E, and C) involved in the pathway leading to correctly folded beta-tubulin from folding intermediates. Cofactors A and D are believed to play a role in capturing and stabilizing beta-tubulin in a quasi-native confirmation. This protein is essential for cell viability and its knockdown produces a decrease in the amount of soluble tubulin, modifications in microtubules and G1 cell cycle arrest. Recombinant human TBCA protein was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04156
Size 100 µg
Host E.coli
Accession
Molecular Weight 12.8 kDa (108aa), confirmed by MALDI-TOF.
AP_Mol_Weight
Tag
Sequences MADPRVRQIKIKTGVVKRLVKEKVMYEKEAKQQEEKIEKMRAEDGENYDIKKQAEILQESRMMIPDCQRRLEAAYLDLQRILENEKDLEEAEEYKEARLVLDSVKLEA
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer pH 7.5 containing 1 mM DTT, 10% glycerol
Other Names Tubulin folding cofactor A, chaperonin cofactor a, tubulin specific chaperone a, TBCA, Tubulin folding cofactor A CFA, Co chaperonin associated with a & b tubulin, Cofactor A, TCP1 chaperonin cofactor A, Tubulin cofactor a.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap