TAX1BP3, 1-124aa, Human, His tag E.coli

Categories: [Proteins / Peptides]
TAX1BP3, also known as Tax1-binding protein 3, contains one PDZ domain, through which most of its interactions with other proteins are made. The PDZ domain of TAX1BP3 interacts with the C-terminus of Rhotekin to facilitate Rho-mediated activation of the FOS serum response element. The PDZ domain also interacts with beta-catenin to inhibit the transcriptional activity of beta-catenin. It has been detected in a variety of cell lines, including HeLa, and is weakly expressed in peripheral blood leukocytes. Recombinant human TAX1BP3 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP04152
Size 100 µg
Host E.coli
Accession
Molecular Weight 15.8 kDa (144aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMSYIPGQPVTAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRVSEGGPAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSMLS
Purity > 95% by HPLC
Concentration 1.0 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 20% glycerol, 0.1M NaCl,1mM DTT
Other Names Tax1-binding protein 3, TIP-1, TIP1
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap