GUK1, 1-197aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
GUK1, also known as GMK, belongs to the guanylate kinase family. This protein exists as a monomer that catalyzes the ATP-dependent conversion of GMP to GDP, thereby playing an essential role in the recycling of GMP. Via its catalytic activity, GUK1 is thought to participate in regulating the supply of guanine nucleotides to signal transduction pathways.
List Price: $198
  • Buy 5 for $188.1 each and save 5%
  • Buy 21 for $178.2 each and save 10%
  • Buy 31 for $168.3 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02375
Size 100 µg
Host E.coli
Accession
Molecular Weight 23.9 kDa (217aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGA
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer(pH 8.0) containing 10% glycerol 1mM DTT, 0.1M NaCl.
Other Names Guanylate kinase, GMK, GMP kinase
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap