FADD, 1-208 aa, Human, His-tag, E.coli

Categories: [Proteins / Peptides]
FADD (Fas-associated protein with death domain) is an adaptor molecule that interacts with various cell surface receptors and mediates cell apoptotic signals. This protein is implicated in survival/proliferation and cell cycle progression. FADD functions are also regulated via cellular sublocalization, protein phosphorylation, and inhibitory molecules. Recombinant FADD protein was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $414
  • Buy 5 for $393.3 each and save 5%
  • Buy 21 for $372.6 each and save 10%
  • Buy 31 for $351.9 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02080
Size 50 µg
Host E.coli
Accession
Molecular Weight 27.4 kDa (244aa)
AP_Mol_Weight
Tag
Sequences MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWNSDASTSEAS
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol.
Other Names Fas-associated via death domain, GIG3, MORT1
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap