Home / Products / proteins / eIF4E-BP1, 1-118 aa, Human, His-tagged, Recombinant, E.coli

eIF4E-BP1, 1-118 aa, Human, His-tagged, Recombinant, E.coli

Categories: [Proteins / Peptides]
eIF4E-BP1, also known as eukaryotic translation initiation factor 4E-binding protein 1, is a member of a family of translation repressor proteins. This protein regulates eukaryotic translation initiation factor 4E (eIF4E) activity by preventing its assembly into the eIF4F complex and mediates the regulation of protein translation by hormones, growth factors and other stimuli that signal through the MAP kinase and mTORC1 pathways.
List Price: $256
  • Buy 5 for $243.2 each and save 5%
  • Buy 21 for $230.4 each and save 10%
  • Buy 31 for $217.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02001
Size 100 µg
Host E.coli
Accession
Molecular Weight 14.7 kDa (138aa) (Real molecular weight on SDS-PAGE will be shift up).
AP_Mol_Weight
Tag
Sequences MGSSHHHHHHSSGLVPRGSHMSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by BCA assay).
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names Eukaryotic translation initiation factor 4E-binding protein 1, 4E-BP1, 4EBP1, BP-1, MGC4316, PHAS-I.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap