EHF, 1-300aa, Human His tag, E.coli

Categories: [Proteins / Peptides]
ETS homologous factor isoform 2, also known as EHF, is a distinct member of the ESE subfamily of Ets transcription factors. Ets factors constitute one important class of transcriptional regulators that play critical roles in hema-topoiesis, angiogenesis, organogenesis, oncogenesis and specification of neuronal connectivity. It is exclusively expressed in a subset of epithelial cells, with highest expression detected in glandular epithelium of the prostate, pancreas, salivary gland and trachea. EHF transactivates the c-Met promoter via three high affinity binding sites, which suggests that EHF may contribute to branching morphogenesis. Recombinant human EHF protein, fused to His-tag at N-terminus, was expressed in E.coli.
List Price: $414
  • Buy 5 for $393.3 each and save 5%
  • Buy 21 for $372.6 each and save 10%
  • Buy 31 for $351.9 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01987
Size 50 µg
Host E.coli
Accession
Molecular Weight 37.3 kDa (323aa)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMILEGGGVMNLNPGNNLLHQPPAWTDSYSTCNVSSGFFGGQWHEIHPQYWTKYQVWEWLQHLLDTNQLDANCIPFQEFDINGEHLCSMSLQEFTRAAGTAGQLLYSNLQHLKWNGQCSSDLFQSTHNVIVKTEQTEPSIMNTWKDENYLYDTNYGSTVDLLDSKTFCRAQISMTTTSHLPVAESPDMKKEQDPPAKCHTKKHNPRGTHLWEFIRDILLNPDKNPGLIKWEDRSEGVFRFLKSEAVAQLWGKKKNNSSMTYEKLSRAMRYYYKREILERVDGRRLVYKFGKNARGWRENEN
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.4M Urea, 10% glycerol
Other Names ETS homologous factor isoform 2, ESE3, ESE3B, ESEJ
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap