Home / Products / proteins / EGF, 977-1029aa, Mouse, His tag, E.coli

EGF, 977-1029aa, Mouse, His tag, E.coli

Categories: [Proteins / Peptides]
Recombinant mouse epidermal growth factor (EGF) is a 8.6 kDa globular protein containing 77 amino acids residues, including 3 intra-molecular disulfide bonds. EGF is a potent growth factor that stimulates the proliferation of various epidermal and epithelial cells. Additionally, EGF has been shown to inhibit gastric secretion, and to be involved in wound healing.
List Price: $220
  • Buy 5 for $209 each and save 5%
  • Buy 21 for $198 each and save 10%
  • Buy 31 for $187 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01983
Size 20 µg
Host E.coli
Accession
Molecular Weight 8.6kDa (77aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMNSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 2mM DTT, 10% glycerol, 100mM NaCl
Other Names Epidermal growth factor.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap