EFNB3, 28-226aa, Human, His-tag, Baculovirus

Categories: [Proteins / Peptides]
EFNB3, also known as ephrin-B3, is a member of the Ephrin-B family of transmembrane ligands that bind and induce the tyrosine autophosphorylation of Eph receptors. EFNB3 is expressed on oligodendrocytes and neurons in the hippocampus and along the midline of the spinal cord. It’s up-regulated in glioma and promotes tumor cell invasion and migration. This protein acts as the midline barrier that prevents corticospinal tract projections from recrossing when they enter the spinal gray matter. Recombinant human EFNB3, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $302
  • Buy 5 for $286.9 each and save 5%
  • Buy 21 for $271.8 each and save 10%
  • Buy 31 for $256.7 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01982
Size 50 µg
Host Baculovirus
Accession
Molecular Weight 23.0kDa (208aa), 28-40KDa (SDS-PAGE under reducing conditions.)
AP_Mol_Weight
Tag
Sequences ADPLSLEPVYWNSANKRFQAEGGYVLYPQIGDRLDLLCPRARPPGPHSSPNYEFYKLYLVGGAQGRRCEAPPAPNLLLTCDRPDLDLRFTIKFQEYSPNLWGHEFRSHHDYYIIATSDGTREGLESLQGGVCLTRGMKVLLRVGQSPRGGAVPRKPVSEMPMERDRGAAHSLEPGKENLPGDPTSNATSRGAEGPLPPPSMPHHHHHH
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Absorbance at 280nm)
Formulation In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names Ephrin-B3, EFNB3, EFL6, EPLG8, LERK8
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap