EEF1B2, 1-225aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Elongation factor 1-beta, also known as EEF1B2, is a translation elongation factor. The protein is a guanine nucleotide exchange factor involved in the transfer of aminoacylated tRNAs to the ribosome. EEF1B2 and EEF1D stimulate the exchange of GDP bound to EEF1A to GTP. Recombinant human EEF1B2 protein, fused to His-tag at C-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01970
Size 10 µg
Host E.coli
Accession
Molecular Weight 25.8kDa (233aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLPGVKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREERLAQYESKKAKKPALVAKSSILLDVKPWDDETDMAKLEECVRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGTDMLEEQITAFEDYVQSMDVAAFNKILEHHHHHH
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 10% glycerol,1mM DTT, 100mM NaCl
Other Names Elongation factor 1-beta, EF-1-beta, EEF1B, EEF1B1, EF1B
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap