DUSP18, 1-188aa, Human, His-tag, E.coli (Bioactivity Validated)

Categories: [Proteins / Peptides]
Dual specificity phosphatase 18, also known as DUSP18, is a member of the dual-specificity phosphatase (DSP) family, which catalyzes dephosphorylation of phosphotyrosine and phosphothreonine residues. DUSP18 is inhibited by iodoarectic acid and is activated by manganese ions. Along with having preferential enzymatic activity against phosphorylated tyrosine residues over threonine residues, DUSP18 also dephosphorylates p-nitrophenyl phosphate (pNPP) in vitro. This protein is widely expressed with highest levels in liver, brain, ovary and testis. Recombinant human DUSP18 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $131
  • Buy 5 for $124.45 each and save 5%
  • Buy 21 for $117.9 each and save 10%
  • Buy 31 for $111.35 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01934
Size 20 µg
Host E.coli
Accession
Molecular Weight 23.6 kDa (212aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MGSSHHHHHHSSGLVPRGSHMGSHMTAPSCAFPVQFRQPSVSGLSQITKSLYISNGVAANNKLMLSSNQITMVINVSVEVVNTLYEDIQYMQVPVADSPNSRLCDFFDPIADHIHSVEMKQGRTLLHCAAGVSRSAALCLAYLMKYHAMSLLDAHTWTKSCRPIIRPNSGFWEQLIHYEFQLFGKNTVHMVSSPVGMIPDIYEKEVRLMIPL
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 1mM DTT, 40% glycerol, 0.1mM PMSF, 1mM EDTA
Other Names Dual specificity protein phosphatase 18, DSP18, DUSP20
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap