Home / Products / proteins / DUSP13, 1-198aa Human, His tag, E.coli

DUSP13, 1-198aa Human, His tag, E.coli

Categories: [Proteins / Peptides]
DUSP13 (Dual specificity phosphatase 13) belongs to the protein-tyrosine phosphatase family. It cooperates with protein kinases to regulate cell proliferation and differentiation. DUSP13 is involved in the regulation of meiosis and/or differentiation of testicular germ cells during spermatogenesis.
List Price: $414
  • Buy 5 for $393.3 each and save 5%
  • Buy 21 for $372.6 each and save 10%
  • Buy 31 for $351.9 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01932
Size 50 µg
Host E.coli
Accession
Molecular Weight 24.7kDa (222aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSHMDSLQKQDLRRPKIHGAVQASPYQPPTLASLQRLLWVRQAATLNHIDEVWPSLFLGDAYAARDKSKLIQLGITHVVNAAAGKFQVDTGAKFYRGMSLEYYGIEADDNPFFDLSVYFLPVARYIRAALSVPQGRVLVHCAMGVSRSATLVLAFLMICENMTLVEAIQTVQAHRNICPNSGFLRQLQVLDNRLGRETGRF
Purity > 95% by HPLC
Concentration 0.5mg/ml
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 20% glycerol, 0.1M NaCl, 1mM DTT
Other Names Dual specificity phosphatase 13, BEDP, DUSP13A, DUSP13B, MDSP, SKRP4, TMDP.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap