Home / Products / proteins / Dkk-1, 32-266aa, Human, His-tagged, Recombinant, Hi-5 cell

Dkk-1, 32-266aa, Human, His-tagged, Recombinant, Hi-5 cell

Categories: [Proteins / Peptides]
Dickkopf-related protein 1, also known as Dkk-1, is a member of the Dkk protein family including Dkk-1, 2, 3 and -4. It is a secreted protein with two cysteine rich regions and is involved in embryonic development through its inhibition of the WNT signaling pathway.
List Price: $438
  • Buy 5 for $416.1 each and save 5%
  • Buy 21 for $394.2 each and save 10%
  • Buy 31 for $372.3 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01884
Size 10 µg
Host
Accession
Molecular Weight 27.8 kDa (253 aa), (On SDS-PAGE under denatured condition, apparent molecular weight ofglycosylated rhDkk-1 protein will appear at approximately 40kDa)
AP_Mol_Weight
Tag
Sequences ADPTLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRHSGRLVPRGSHHHHHH
Purity > 95% by HPLC
Concentration 0.25 mg/ml (determined by Bradford assay)
Formulation Liquid. In PBS (pH 7.4) containing 30% glycerol, 2mM DTT, 2mM EDTA, 0.1mM PMSF.
Other Names Dickkopf-related protein 1, Dickkopf-1, hDkk-1, SK
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap